PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010552727.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 181aa    MW: 20511.4 Da    PI: 10.4555
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010552727.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.1e-1562104448
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++ +Ed+l+++++++lG++ W++Ia +++ gR++ q++++w+++l
   XP_010552727.1  62 FSGDEDDLIIKLHALLGNR-WSLIAGRLP-GRSDDQVRNHWNSHL 104
                      7789***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-53666IPR009057Homeodomain-like
SuperFamilySSF466894.24E-1940113IPR009057Homeodomain-like
PROSITE profilePS5129425.57954108IPR017930Myb domain
SMARTSM007171.7E-1458106IPR001005SANT/Myb domain
PfamPF002492.5E-1460104IPR001005SANT/Myb domain
CDDcd001673.11E-1262104No hitNo description
Gene3DG3DSA:1.10.10.604.7E-2067105IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MRSLTTQEDM KRGALIMSEQ VNRKLIHTFR YRRGRLPLVR CGKSCRARRI NHARPELKTG  60
GFSGDEDDLI IKLHALLGNR WSLIAGRLPG RSDDQVRNHW NSHLKRKLMN MGMDPSNHRL  120
NHHNHCFCGR EPHNNAMADI AYKADDESSA SHSTGPSDHG IVPVDPMPPT ASLLERIINV  180
S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-20410810108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010552727.11e-133PREDICTED: myb-related protein 330 isoform X3
TrEMBLQ8H2532e-44Q8H253_9R
STRINGVIT_01s0011g04760.t012e-42(Vitis vinifera)
STRINGSolyc05g008250.1.11e-42(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-38myb domain protein 4